{"product_id":"proteintech-27774-1-ap","title":"Proteintech, 27774-1-AP, TRAPPC11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRAPPC11 (27774-1-AP) by Proteintech is a Polyclonal antibody targeting TRAPPC11 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n27774-1-AP targets TRAPPC11 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, U2OS cells,  mouse brain tissue,  rat brain tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTRAPPC11 is a subunit of the TRAPP (transport protein particle) tethering complex, which functions in intracellular vesicle trafficking. This subunit is involved in early stage endoplasmic reticulum-to-Golgi vesicle transport. Mutations in TRAPPC11 result in neuromuscular and developmental phenotypes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27096 Product name: Recombinant human C4orf41 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 519-735 aa of BC022185 Sequence: LLGRASTLKDDQKSRIEKNLINVLMNESPDPEPDCDILAVKTAQKLWADRISLAGSNIFTIGVQDFVPFVQCKAKFHAPSFHVDVPVQFDIYLKADCPHPIRFSKLCVSFNNQEYNQFCVIEEASKANEVLENLTQGKMCLVPGKTRKLLFKFVAKTEDVGKKIEITSVDLALGNETGRCVVLNWQGGGGDAASSQEALQAARSFKRRPKLPDNEVH Predict reactive species\nFull Name: chromosome 4 open reading frame 41\nObserved Molecular Weight: 129 kDa\nGenBank Accession Number: BC022185\nGene Symbol: TRAPPC11\nGene ID (NCBI): 60684\nRRID: AB_3085995\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7Z392\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887837302953,"sku":"27774-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27774-1-ap","provider":"Iright","version":"1.0","type":"link"}