{"product_id":"proteintech-27792-1-ap","title":"Proteintech, 27792-1-AP, Oncostatin M Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Oncostatin M (27792-1-AP) by Proteintech is a Polyclonal antibody targeting Oncostatin M in WB, IHC, ELISA applications with reactivity to human, rat samples\n27792-1-AP targets Oncostatin M in WB, IHC, IF, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, Jurkat cells,  rat testis tissue\nPositive IHC detected in: human colon cancer tissue, human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOncostatin M (OSM) is a multifunctional cytokine that belongs to the interleukin-6 (IL-6) family. It is primarily secreted by activated T lymphocytes and macrophages as a 28 kDa glycoprotein. OSM shares properties with all members of this cytokine family, but is most closely related in structure and function to leukemia inhibitory factor (LIF). OSM acts on a variety of cells and is involved in regulating gene activation, cell growth, and inflammatory processes. It is a potent inducer of anti-proteases, has anti-inflammatory properties, acts as an immune modifier, and promotes the deposition of extracellular matrix proteins\n. In the context of respiratory diseases, OSM may play a significant role in normal wound healing, as well as in remodeling and pathological fibrosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27093 Product name: Recombinant human OSM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-221 aa of BC011589 Sequence: AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR Predict reactive species\nFull Name: oncostatin M\nCalculated Molecular Weight: 252 aa, 28 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC011589\nGene Symbol: OSM\nGene ID (NCBI): 5008\nRRID: AB_2880974\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P13725\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869420507305,"sku":"27792-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27792-1-ap","provider":"Iright","version":"1.0","type":"link"}