{"product_id":"proteintech-27801-1-ap","title":"Proteintech, 27801-1-AP, SPG7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPG7 (27801-1-AP) by Proteintech is a Polyclonal antibody targeting SPG7 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n27801-1-AP targets SPG7 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  LNCaP cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSPG7 encodes a nuclear-encoded mitochondrial metalloprotease protein that is a member of the AAA protein family. Two transcript variants encoding distinct isoforms have been identified. The molecular weight of SPG7 is about 88-100 kDa (precursor),80 kDa (intermediate) and 70 kDa (mature)(PMID: 24767997), while the molecular weight of isoform 2 is about 54 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26265 Product name: Recombinant human SPG7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-45 aa of BC007692 Sequence: VATEAQVPFLAMAGPEFVEVIGGLGAARVRSLFKEARARAPCIVY Predict reactive species\nFull Name: spastic paraplegia 7 (pure and complicated autosomal recessive)\nCalculated Molecular Weight: 88 kDa\nObserved Molecular Weight: 54 kDa, 70 kDa, 80kDa\nGenBank Accession Number: BC007692\nGene Symbol: SPG7\nGene ID (NCBI): 6687\nRRID: AB_2918133\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UQ90\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887814561961,"sku":"27801-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27801-1-ap","provider":"Iright","version":"1.0","type":"link"}