{"product_id":"proteintech-27823-1-ap","title":"Proteintech, 27823-1-AP, CD107b \/ LAMP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD107b \/ LAMP2 (27823-1-AP) by Proteintech is a Polyclonal antibody targeting CD107b \/ LAMP2 in WB, IHC, ELISA applications with reactivity to human, pig samples\n27823-1-AP targets CD107b \/ LAMP2 in WB, IHC, IF, ELISA applications and shows reactivity with human, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, Jurkat cells,  pig liver tissue,  human placenta tissue\nPositive IHC detected in: human liver tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLysosomal-associated membrane protein 2 (LAMP2, synonyms: LAMPB, CD107b) is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. LAMP2 may plays a role in tumor cell metastasis. It may also functions in the protection, maintenance, and adhesion of the lysosome. Prior to posttranslational modification, LAMP2 is a ~45 kDa polypeptide. Mature, functional LAMP2 is extensively glycosylated with a variety of different N linked and O linked oligosaccharides.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, pig\nCited Reactivity: human, pig, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27183 Product name: Recombinant human LAMP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-230 aa of BC002965 Sequence: LELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSPTTTPTPKEKPEAGTYSVNNGND Predict reactive species\nFull Name: lysosomal-associated membrane protein 2\nCalculated Molecular Weight: 45 kDa\nObserved Molecular Weight: 120 kDa\nGenBank Accession Number: BC002965\nGene Symbol: LAMP2\nGene ID (NCBI): 3920\nENSEMBL Gene ID: ENSG00000005893\nRRID: AB_2880983\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P13473\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868835106985,"sku":"27823-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27823-1-ap","provider":"Iright","version":"1.0","type":"link"}