{"product_id":"proteintech-27828-1-ap","title":"Proteintech, 27828-1-AP, SIGIRR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SIGIRR (27828-1-AP) by Proteintech is a Polyclonal antibody targeting SIGIRR in WB, IHC, ELISA applications with reactivity to human, mouse samples\n27828-1-AP targets SIGIRR in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human ovary cancer tissue,  mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSIGIRR (also known as TIR8) is a member of the toll-like receptor (TLR)\/interleukin 1 receptor (IL-1R) superfamily, with a single immunoglobulin extracellular domain and a TIR (Toll\/IL-1R) intracellular domain. SIGIRR functions as a negative regulator for IL-1 and LPS signaling, through its interaction with the TLR4 and IL-1R complex. SIGIRR is an important modulator of intestinal epithelial homeostasis and a key regulator of mucosal immunity, maintaining microbial tolerance of the intestinal epithelial layer (PMID: 17398123). The molecular weight of the glycosylated SIGIRR was found to be in the range 50-80 kDa (PMID: 10346978; 17495864).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25850 Product name: Recombinant human SIGIRR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC025953 Sequence: MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGGHYSLHEYSWVKANLSEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSH Predict reactive species\nFull Name: single immunoglobulin and toll-interleukin 1 receptor (TIR) domain\nCalculated Molecular Weight: 46 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC025953\nGene Symbol: SIGIRR\nGene ID (NCBI): 59307\nRRID: AB_2880984\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6IA17\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869430304937,"sku":"27828-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27828-1-ap","provider":"Iright","version":"1.0","type":"link"}