{"product_id":"proteintech-27832-1-ap","title":"Proteintech, 27832-1-AP, MTSS1L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MTSS1L (27832-1-AP) by Proteintech is a Polyclonal antibody targeting MTSS1L in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n27832-1-AP targets MTSS1L in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HeLa cells,  Jurkat cells,  U-251 cells,  NIH\/3T3 cells,  mouse brain tissue,  rat brain tissue\nPositive IP detected in: Jurkat cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMTSS2, also known as MTSS1L, contains a conserved N-terminal domain, called an IRSP53 \/MIM homology domain (IMD) or inverse BAR domain, that is involved in plasma membrane dynamics (PMID: 20875796). MTSS2 potentiated PDGF-mediated formation of membrane ruffles and lamellipodia in fibroblasts, acting via RAC1 activation (PMID:14752106). MTSS2 is implicated in intellectual developmental disorders with ocular anomalies and distinctive facial features(PMID: 36067766).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27216 Product name: Recombinant human MTSS1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 196-246 aa of BC002770 Sequence: TFITFLQPVVNGELTMLGEITHLQGIIDDLVVLTAEPHKLPPASEQVIKDL Predict reactive species\nFull Name: metastasis suppressor 1-like\nObserved Molecular Weight: 68-70 kDa\nGenBank Accession Number: BC002770\nGene Symbol: MTSS1L\nGene ID (NCBI): 92154\nRRID: AB_2880986\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q765P7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869563080873,"sku":"27832-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27832-1-ap","provider":"Iright","version":"1.0","type":"link"}