{"product_id":"proteintech-27848-1-ap","title":"Proteintech, 27848-1-AP, ABCC6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ABCC6 (27848-1-AP) by Proteintech is a Polyclonal antibody targeting ABCC6 in WB, IHC, ELISA applications with reactivity to Human, Mouse samples\n27848-1-AP targets ABCC6 in WB, IF, IHC, ELISA applications and shows reactivity with Human, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe ATP-binding cassette transporter 6 (ABCC6) gene, also named as MRP6, is a cellular transmembrane protein transporter and belongs to ATP-binding cassette (ABC)  family. ABCC6 is an ATP-dependent transporter contains two ATP-binding domains. It is mainly found in the liver, the proximal tubules of the kidneys and the intestines. ABCC6 is involved in a pathway of extracellular nucleotide metabolism and the regulation of tissue calcification. Mutations of ABCC6 leads to pseudoxanthoma elasticum (PXE) which is a rare autosomal recessive disorder. Mutations of ABCC6 can also lead generalized arterial calcification of infancy-2 (GACI2). 27848-1-AP detects two isoforms of ABCC6 protein around 165 kDa and 96 kDa in SDS-PAGE.(PMID:28891970, 29709427,  29662086, 15888484)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18640 Product name: Recombinant human ABCC6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1219-1503 aa of BC131732 Sequence: VVRNWTDLENSIVSVERMQDYAWTPKEAPWRLPTCAAQPPWPQGGQIEFRDFGLRYRPELPLAVQGVSFKIHAGEKVGIVGRTGAGKSSLASGLLRLQEAAEGGIWIDGVPIAHVGLHTLRSRISIIPQDPILFPGSLRMNLDLLQEHSDEAIWAALETVQLKALVASLPGQLQYKCADRGEDLSVGQKQLLCLARALLRKTQILILDEATAAVDPGTELQMQAMLGSWFAQCTVLLIAHRLRSVMDCARVLVMDKGQVAESGSPAQLLAQKGLFYRLAQESGLV Predict reactive species\nFull Name: ATP-binding cassette, sub-family C (CFTR\/MRP), member 6\nCalculated Molecular Weight: 1503 aa, 165 kDa\nObserved Molecular Weight: 165 kDa and 96 kDa\nGenBank Accession Number: BC131732\nGene Symbol: ABCC6\nGene ID (NCBI): 368\nRRID: AB_2880992\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95255\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868991705257,"sku":"27848-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27848-1-ap","provider":"Iright","version":"1.0","type":"link"}