{"product_id":"proteintech-27849-1-ap","title":"Proteintech, 27849-1-AP, SMIM1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SMIM1 (27849-1-AP) by Proteintech is a Polyclonal antibody targeting SMIM1 in WB, ELISA applications with reactivity to Human, Mouse samples\n27849-1-AP targets SMIM1 in WB, ELISA applications and shows reactivity with Human, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse kidney tissue,  mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSmall integral membrane protein 1(SMIM1) is a type II transmembrane phosphoprotein and displays the Vel blood group antigen at its carboxyl-terminus. SMIM1 is highly expressed in hematopoietic cells. It is associated with a variety of immune responses and plays an important role in RBC differentiation. SMIM1 can be used as a potential biomarker for the diagnosis of IDD (PMID: 30906890; 26452714).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27028 Product name: Recombinant human LOC388588 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-78 aa of BC146957 Sequence: MQPQESHVHYSRWEDGSRDGVSLGAVSSTEEASRCRRISQRLCTGKLGIAMKVLGGVALFWIIFILGYLTGYYVHKCK Predict reactive species\nFull Name: hypothetical LOC388588\nObserved Molecular Weight: 9 kDa\nGenBank Accession Number: BC146957\nGene Symbol: SMIM1\nGene ID (NCBI): 388588\nRRID: AB_2880993\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: B2RUZ4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869768044713,"sku":"27849-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27849-1-ap","provider":"Iright","version":"1.0","type":"link"}