{"product_id":"proteintech-27871-1-ap","title":"Proteintech, 27871-1-AP, Endothelin 3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Endothelin 3 (27871-1-AP) by Proteintech is a Polyclonal antibody targeting Endothelin 3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n27871-1-AP targets Endothelin 3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse pancreas tissue, rat pancreas tissue\nPositive IHC detected in: human thyroid cancer tissue, human oesophagus cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: NIH\/3T3 cells, BxPC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEndothelin 3 (EDN3) is also named as ET-3 and Preproendothelin-3 (PPET3). Endothelin 3 belongs to the endothelin\/sarafotoxin family. It reported downregulation of EDN3 as a result of methylation of its promoter in breast cancer, and EDN3 level was also decreased in cervical cancer (PMID: 36542159). ET-3 is the most abundant ET peptide in the rat brain, mainly localized to neurons and glia of the neostriatum, hypothalamic nuclei, hippocampus, and Purkinje cells of the cerebellum and medulla oblongata (PMID: 32589590).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27393 Product name: Recombinant human EDN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-198 aa of BC053866 Sequence: SQSGDAGRRGVSQAPTAARSEGDCEETVAGPGEETVAGPGEGTVAPTALQGPSPGSPGQEQAAEGAPEHHRSRRCTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFRGKRSAGPLPGNLQLSHRPHLRCACVGRYDKACLHFCTQTLDVSSNSRTAEKTDKEEEGKVE Predict reactive species\nFull Name: endothelin 3\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC053866\nGene Symbol: Endothelin 3\nGene ID (NCBI): 1908\nRRID: AB_3086000\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P14138\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869678620841,"sku":"27871-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27871-1-ap","provider":"Iright","version":"1.0","type":"link"}