{"product_id":"proteintech-27897-1-ap","title":"Proteintech, 27897-1-AP, NLRP7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NLRP7 (27897-1-AP) by Proteintech is a Polyclonal antibody targeting NLRP7 in WB, IHC, ELISA applications with reactivity to human samples\n27897-1-AP targets NLRP7 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, THP-1 cells\nPositive IHC detected in: human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNLRP7, also called NALP7 or PYPAF3, is a member of the NOD-like receptors (NLR), a family of proteins that plays a crucial role in the innate immune response. NLRP7 has been reported to emerge from NLRP2 gene. Similar to all inflammasomes, NLRP7 contributes to both pro- and an anti-inflammatory processes, depending on whether it functions in an inflammasome-dependent or independent pathway. The function of NLRP7 inflammasome has also been reported to depend on the master regulatory transcription factor protein that controls cellular inflammation, the NF-kB. In addition to its pro- and anti-inflammatory actions, NLRP7 plays a role in restricting intracellular bacterial replication and can also induce inflammasome assembly upon specific stimulation by FSL-1 (diacylated lipoprotein).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27465 Product name: Recombinant human NLRP7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-171 aa of BC109125 Sequence: MTSPQLEWTLQTLLEQLNEDELKSFKSLLWAFPLEDVLQKTPWSEVEEADGKKLAEILVNTSSENWIRNATVNILEEMNLTELCKMAKAEMMEDGQVQEIDNPELGDAEEDSELAKPGEKEGWRNSMEKQSLVWKNTFWQGDIDNFHDDVTLRNQRFIPFLNPRTPRKLTP Predict reactive species\nFull Name: NLR family, pyrin domain containing 7\nCalculated Molecular Weight: 112 kDa, 115 kDa, 118 kDa\nObserved Molecular Weight: 112 kDa\nGenBank Accession Number: BC109125\nGene Symbol: NLRP7\nGene ID (NCBI): 199713\nRRID: AB_3086005\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WX94\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887739097257,"sku":"27897-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27897-1-ap","provider":"Iright","version":"1.0","type":"link"}