{"product_id":"proteintech-27938-1-ap","title":"Proteintech, 27938-1-AP, SLC10A6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC10A6 (27938-1-AP) by Proteintech is a Polyclonal antibody targeting SLC10A6 in WB, IHC, ELISA applications with reactivity to Human, Mouse samples\n27938-1-AP targets SLC10A6 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue\nPositive IHC detected in: mouse heart tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC10A6, also named as SOAT, belongs to the SlC10 sodium-dependent bile acid (BA) transporter family. SLC10A6 is a transporter of steroid sulfates associated with spermatogenesis and fertility. It has been shown that SLC10A6 might be a new anti-proliferative breast cancer target as the SLC10A6 inhibition can affect the proliferation of breast cancer cells. SLC10A6 also plays a key role in hepatic inflammation. 27938-1-AP antibody detects the 70 kDa glycosylated form in SDS-PAGE. (PMID: 26510996, 30186172, 28893621)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16609 Product name: Recombinant human SLC10A6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 301-377 aa of BC107051 Sequence: GFLIVAAYQTYKRRLKNKHGKKNSGCTEVCHTRKSTSSRETNAFLEVNEEGAITPGPPGPMDCHRALEPVGHITSCE Predict reactive species\nFull Name: solute carrier family 10 (sodium\/bile acid cotransporter family), member 6\nCalculated Molecular Weight: 377 aa, 41 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC107051\nGene Symbol: SLC10A6\nGene ID (NCBI): 345274\nRRID: AB_2881014\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q3KNW5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887803257001,"sku":"27938-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27938-1-ap","provider":"Iright","version":"1.0","type":"link"}