{"product_id":"proteintech-27969-1-ap","title":"Proteintech, 27969-1-AP, C1orf2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C1orf2 (27969-1-AP) by Proteintech is a Polyclonal antibody targeting C1orf2 in WB, ELISA applications with reactivity to human samples\n27969-1-AP targets C1orf2 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC1orf2 is also named COTE1, FAM189B and ENTREP3. C1orf2 is identified as a potential binding partner of a WW domain-containing protein which is involved in apoptosis and tumor suppression. Alternative splicing results in multiple transcript variants. COTE1 contributes to human hepatocarcinogenesis by regulating cell proliferation through the modulation of WWOX signaling, and it upregulated in hepatocellular carcinoma specimens and HCC cell lines (PMID: 23317259, PMID: 24899407).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27428 Product name: Recombinant human C1orf2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 437-654 aa of BC006493 Sequence: PELRRRVPRGGGRPAAAPPTRAPTRRFSDSSGSLTPPGHRPPHPASPPPLLLPRSHSDPGITTSSDTADFRDLYTKVLEEEAASVSSADTGLCSEACLFRLARCPSPKLLRARSAEKRRPVPTFQKVPLPSGPAPAHSLGDLKGSWPGRGLVTRFLQISRKAPDPSGTGAHGHKQVPRSLWGRPGRESLHLRSCGDLSSSSSLRRLLSGRRLERGTRP Predict reactive species\nFull Name: chromosome 1 open reading frame 2\nCalculated Molecular Weight: 669 aa, 71 kDa\nObserved Molecular Weight: 69-71 kDa\nGenBank Accession Number: BC006493\nGene Symbol: C1orf2\nGene ID (NCBI): 10712\nRRID: AB_3086017\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P81408\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869519728809,"sku":"27969-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27969-1-ap","provider":"Iright","version":"1.0","type":"link"}