{"product_id":"proteintech-27980-1-ap","title":"Proteintech, 27980-1-AP, ANK3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ANK3 (27980-1-AP) by Proteintech is a Polyclonal antibody targeting ANK3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, Mouse, Rat samples\n27980-1-AP targets ANK3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: human breast cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nANK3 is associated with neurodevelopment and neuronal function. It has been reported that ANK3 plays a key role in bipolar disorder. ANK3 is expressed in brain at a high level. There are several isoforms of ANK3 associated with different tissue expression and function. The immune region we selected can recognize 480 kDa, 204 kDa, 202 kDa and 111 kDa protein and 27980-1-AP detects 204 kDa isoform in SDS-PAGE. (PMID: 27217151, 28687526, 30297702, 28109561, 30046097)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nCited Reactivity: human, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27635 Product name: Recombinant human ANK3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 4221-4377 aa of NM_001149 Sequence: MGLLDRLDDSPDQCRDSITSYLKGEAGKFEANGSHTEITPEAKTKSYFPESQNDVGKQSTKETLKPKIHGSGHVEEPASPLAAYQKSLEETSKLIIEETKPCVPVSMKKMSRTSPADGKPRLSLHEEEGSSGSEQKQGEGFKVKTKKEIRHVEKKSHS Predict reactive species\nFull Name: ankyrin 3, node of Ranvier (ankyrin G)\nCalculated Molecular Weight: 480 kDa\nObserved Molecular Weight: 160 kDa, 204 kDa\nGenBank Accession Number: NM_001149\nGene Symbol: ANK3\nGene ID (NCBI): 288\nRRID: AB_2881028\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q12955\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869514485929,"sku":"27980-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27980-1-ap","provider":"Iright","version":"1.0","type":"link"}