{"product_id":"proteintech-27987-1-ap","title":"Proteintech, 27987-1-AP, RBMXL2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RBMXL2 (27987-1-AP) by Proteintech is a Polyclonal antibody targeting RBMXL2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n27987-1-AP targets RBMXL2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRBMXL2 (RNA-binding motif protein, X-linked-like-2), also known as heterogeneous nuclear ribonucleoproteins G-testis or hnRNP-GT, is a testis-specific nuclear RNA binding protein that plays a crucial role in male meiosis (PMID: 34927545). The protein is part of an anciently diverged family of RNA-binding proteins and shares significant homology with RBMX, another RNA-binding protein that is important for controlling splicing, transcription, and genome stability (PMID: 39356106). The expression of RBMXL2 is restricted to the testis, and it is highly expressed during the pachytene and diplotene stages of meiosis, which are characterized by high levels of transcription and alternative splicing (PMID: 34927545).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27624 Product name: Recombinant human RBMXL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 271-392 aa of BC057796 Sequence: GDHLSRGSHREPFESYGELRGAAPGRGTPPSYGGGGRYEEYRGYSPDAYSGGRDSYSSSYGRSDRYSRGRHRVGRPDRGLSLSMERGCPPQRDSYSRSGCRVPRGGGRLGGRLERGGGRSRY Predict reactive species\nFull Name: RNA binding motif protein, X-linked-like 2\nCalculated Molecular Weight: 43 kDa\nObserved Molecular Weight: 43 kDa\nGenBank Accession Number: BC057796\nGene Symbol: RBMXL2\nGene ID (NCBI): 27288\nRRID: AB_3669632\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75526\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887780581545,"sku":"27987-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27987-1-ap","provider":"Iright","version":"1.0","type":"link"}