{"product_id":"proteintech-28005-1-ap","title":"Proteintech, 28005-1-AP, Tissue Factor\/CD142 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Tissue Factor\/CD142 (28005-1-AP) by Proteintech is a Polyclonal antibody targeting Tissue Factor\/CD142 in WB, IHC, ELISA applications with reactivity to human samples\n28005-1-AP targets Tissue Factor\/CD142 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNormal blood coagulation is a complex process, involving a cascade of activation of different plasma proteins, ultimately resulting in the formation of a clot, called fibrin. Tissue Factor (TF), also named Coagulation factor III or F3, is the primary initiator of the blood coagulation cascade and plays an essential role in hemostasis (PMID: 26877187; PMID: 33796108).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27553 Product name: Recombinant human F3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 113-251 aa of BC011029 Sequence: GNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE Predict reactive species\nFull Name: coagulation factor III (thromboplastin, tissue factor)\nCalculated Molecular Weight: 295 aa, 33 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC011029\nGene Symbol: F3\nGene ID (NCBI): 2152\nRRID: AB_3669635\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P13726\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869777645737,"sku":"28005-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28005-1-ap","provider":"Iright","version":"1.0","type":"link"}