{"product_id":"proteintech-28018-1-ap","title":"Proteintech, 28018-1-AP, VRK1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VRK1 (28018-1-AP) by Proteintech is a Polyclonal antibody targeting VRK1 in WB, IHC, ELISA applications with reactivity to human samples\n28018-1-AP targets VRK1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  K-562 cells\nPositive IHC detected in: human skin cancer tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVaccinia-related kinase 1 (VRK1) is a members of the vaccinia-related kinase (VRK) family of serine\/threonine kinases and are principally localized in the nucleus. VRK1 was initially described as a kinase with homology to B1R, a vaccinia virus kinase required for viral DNA replication and the early phase of infection. It has been suggested that VRK1 was overexpressed in numerous human tumors, such as lung carcinomas, hepatocellular carcinoma, breast carcinomas, head and neck squamous cell carcinoma. (PMID: 28927264, PMID: 29103766)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27754 Product name: Recombinant human VRK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 262-396 aa of BC103761 Sequence: EDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK Predict reactive species\nFull Name: vaccinia related kinase 1\nCalculated Molecular Weight: 396 aa, 45 kDa\nObserved Molecular Weight: 45-50 kDa\nGenBank Accession Number: BC103761\nGene Symbol: VRK1\nGene ID (NCBI): 7443\nRRID: AB_2918140\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99986\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869508915369,"sku":"28018-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28018-1-ap","provider":"Iright","version":"1.0","type":"link"}