{"product_id":"proteintech-28021-1-ap","title":"Proteintech, 28021-1-AP, ATG14\/Barkor Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATG14\/Barkor (28021-1-AP) by Proteintech is a Polyclonal antibody targeting ATG14\/Barkor in WB, IP, IHC, ELISA applications with reactivity to Human, Mouse, Rat samples\n28021-1-AP targets ATG14\/Barkor in WB, IHC, IP, ELISA applications and shows reactivity with Human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, A549 cells,  rat brain tissue\nPositive IP detected in: rat brain tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATG14 plays a critical role in autophagy which is required for both basal and inducible autophagy. It has been reported that the loss of ATG14 completely blocks autophagic fusion with lysosomes. ATG14 is associated with the location of PI3-kinase complex PI3KC3-C1 and the formation of autophagosome. Besides, BECN2 can form the BECN2:ATG14 heterodimer with ATG14. 28021-1-AP antibody recognizes the 55 kDa protein and the phosphorylated 65 kDa protein in SDS-PAGE. (PMID: 28218432, 24597603, 30894050)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27671 Product name: Recombinant human ATG14 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-198 aa of NM_014924 Sequence: MASPSGKGARALEAPGCGPRPLARDLVDSVDDAEGLYVAVERCPLCNTTRRRLTCAKCVQSGDFVYFDGRDRERFIDKKERLSRLKSKQEEFQKEVLKAMEGKWITDQLRWKIMSCKMRIEQLKQTICKGNEEMEKNSEGLLKTKEKNQKLYSRAQRHQEKKEKIQRHNRKLGDLVEKKTIDLRSHYERLANLRRSHI Predict reactive species\nFull Name: KIAA0831\nCalculated Molecular Weight: 55 kDa\nObserved Molecular Weight: 55 and 65 kDa\nGenBank Accession Number: NM_014924\nGene Symbol: ATG14\nGene ID (NCBI): 22863\nRRID: AB_2881038\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6ZNE5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868922761385,"sku":"28021-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28021-1-ap","provider":"Iright","version":"1.0","type":"link"}