{"product_id":"proteintech-28035-1-ap","title":"Proteintech, 28035-1-AP, IL-33 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-33 (28035-1-AP) by Proteintech is a Polyclonal antibody targeting IL-33 in WB, IHC, ELISA applications with reactivity to mouse, rat samples\n28035-1-AP targets IL-33 in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue, mouse colon tissue,  rat lung tissue\nPositive IHC detected in: mouse spleen tissue, mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterleukin-33 (IL-33) is a tissue-derived nuclear cytokine from the IL-1 family abundantly expressed in endothelial cells, epithelial cells and fibroblast-like cells, both during homeostasis and inflammation. IL-33 activates many immune cell types involved in type-2 immunity and allergic inflammation, including ILC2s, mast cells, Th2 cells, eosinophils, basophils, dendritic cells and alternatively activated macrophages (AAM). As a cytokine, IL-33 interacts with the receptors ST2 (also known as IL1RL1) and IL-1 Receptor Accessory Protein (IL1RAP), activating intracellular molecules in the NF-κB and MAP kinase signaling pathways that drive production of type 2 cytokines (e.g. IL-5 and IL-13) from polarized Th2 cells. IL-33 is also effective in reversing Alzheimer-like symptoms in APP\/PS1 mice, by reversing the buildup and preventing the new formation of amyloid plaques. IL-33 is synthesized as a 30-34 kD full-length form and  20 kDa form mature form.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27846 Product name: Recombinant mouse IL-33 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 109-266 aa of NM_001164724 Sequence: MSIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI Predict reactive species\nFull Name: interleukin 33\nCalculated Molecular Weight: 30 kDa\nObserved Molecular Weight: 30-35 kDa\nGenBank Accession Number: NM_001164724\nGene Symbol: IL-33\nGene ID (NCBI): 77125\nRRID: AB_2881042\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8BVZ5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868843135145,"sku":"28035-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28035-1-ap","provider":"Iright","version":"1.0","type":"link"}