{"product_id":"proteintech-28046-1-ap","title":"Proteintech, 28046-1-AP, SON Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SON (28046-1-AP) by Proteintech is a Polyclonal antibody targeting SON in IHC, ELISA applications with reactivity to human, mouse samples\n28046-1-AP targets SON in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human thyroid cancer tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:4000-1:16000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSON, also called C21orf50 and DBP5, is a nuclear speckle-localized protein that shares homology with pre-mRNA splicing accessory factors (PMID: 10950926). It is an RNA-binding protein that acts as an mRNA splicing cofactor by promoting efficient splicing of transcripts that possess weak splice sites, and specifically promotes splicing of many cell-cycle and DNA-repair transcripts that possess weak splice sites, such as TUBG1, KATNB1, TUBGCP2, AURKB, PCNT, AKT1, RAD23A, and FANCG (PMID: 20581448; 21504830).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27620 Product name: Recombinant human SON protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-182 aa of NM_001291411 Sequence: MVSKFREIQQELSSGRNEGQLNGETNTPIEGNQAGDAAASARSLPNEEIVQKIEEVLSGVLDTELRYKPDLKEGSRKSRCVSVQTDPTDEIPTKKSKKHKKHKNKKKKKKKEKEKKYKRQPEESESKTKSHDDGNIDLESDSFLKFDSEPSAVALELPTRAFGPSETNES Predict reactive species\nFull Name: SON DNA binding protein\nCalculated Molecular Weight: 264 aa\nGenBank Accession Number: NM_001291411\nGene Symbol: SON\nGene ID (NCBI): 6651\nRRID: AB_3086024\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P18583\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887812235433,"sku":"28046-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28046-1-ap","provider":"Iright","version":"1.0","type":"link"}