{"product_id":"proteintech-28063-1-ap","title":"Proteintech, 28063-1-AP, Red fluorescent protein (RFP611) Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Red fluorescent protein (RFP611) (28063-1-AP) by Proteintech is a Polyclonal antibody targeting Red fluorescent protein (RFP611) in WB, ELISA applications with reactivity to parasicyonis actinostoloides, recombinant protein samples\n28063-1-AP targets Red fluorescent protein (RFP611) in WB, ELISA applications and shows reactivity with parasicyonis actinostoloides, recombinant protein samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Transfected HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRed fluorescent proteins (RFPs) is a collective term referring to a heterogenous group of red chromophore-carrying proteins, originating from various species and forming different protein lineages.\nThe original RFP (dsRed) is a 225 amino acid fluorescent protein (25.9 kDa) derived from Discosoma sp.. It emits red light with a peak wavelength of 593 nm upon excitation by green light (excitation peak at 558 nm). \nWhen fused with other proteins, RFP serves as a versatile reporter protein e.g. for quantifying expression levels or facilitates visualization of subcellular localization through fluorescence microscopy.\nThis antibody is a rabbit polyclonal antibody raised against RFP from Entacmaea quadricolor (eqFP611).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: parasicyonis actinostoloides, recombinant protein\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27893 Product name: Recombinant entacmaea quadricolor Red fluorescent protein protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-231 aa of Sequence: MNSLIKENMRMMVVMEGSVNGYQFKCTGEGDGNPYMGTQTMRIKVVEGGPLPFAFDILATSFMYGSKTFIKHTKGIPDFFKQSFPEGFTWERVTRYEDGGVFTVMQDTSLEDGCLVYHAKVTGVNFPSNGAVMQKKTKGWEPNTEMLYPADGGLRGYSQMALNVDGGGYLSCSFETTYRSKKTVENFKMPGFHFVDHRLERLEESDKEMFVVQHEHAVAKFCDLPSKLGRL Predict reactive species\nFull Name: Red fluorescent protein (RFP611)\nCalculated Molecular Weight: 26 kDa\nRRID: AB_2918144\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8ISF8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887781892265,"sku":"28063-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28063-1-ap","provider":"Iright","version":"1.0","type":"link"}