{"product_id":"proteintech-28083-1-ap","title":"Proteintech, 28083-1-AP, CD31 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD31 (28083-1-AP) by Proteintech is a Polyclonal antibody targeting CD31 in WB, IHC, IF-P, IF-Fro, ELISA applications with reactivity to mouse samples\n28083-1-AP targets CD31 in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: bEnd.3 cells, mouse liver tissue,  mouse spleen tissue\nPositive IHC detected in: mouse liver tissue, mouse brain tissue,  mouse kidney tissue,  mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue, mouse kidney tissue\nPositive IF-Fro detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:4000-1:16000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPlatelet endothelial cell adhesion molecule-1 (PECAM-1, CD31) is a member of the immunoglobulin gene superfamily of cell adhesion molecules. CD31 is a transmembrane glycoprotein that is highly expressed on the surface of the endothelium, making up a large portion of its intracellular junctions. PECAM-1 is also present on the surface of hematopoietic cells and immune cells including platelets, monocytes, neutrophils, natural killer cells, megakaryocytes and some types of T-cell (PMID: 9011572). As well as its role in cell-cell adhesion, PECAM-1 functions as a signaling receptor, and is involved in important physiological events such as nitric oxide production, regulation of T-cell immunity and tolerance, leukocyte transendothelial migration and inflammation and angiogenesis (PMID: 21183735; 20978210; 17872453; 20634489).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27828 Product name: Recombinant mouse Pecam1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 51-276 aa of NM_001032378 Sequence: MISTTSKSRSQHRVLFYKDDAMVYNVTSREHTESYVIPQARVFHSGKYKCTVMLNNKEKTTIEYEVKVHGVSKPKVTLDKKEVTEGGVVTVNCSLQEEKPPIFFKIEKLEVGTKFVKRRIDKTSNENFVLMEFPIEAQDHVLVFRCQAGILSGFKLQESEPIRSEYVTVQESFSTPKFEIKPPGMIIEGDQLHIRCIVQVTHLVQEFTEIIIQKDKAIVATSKQSSE Predict reactive species\nFull Name: platelet\/endothelial cell adhesion molecule 1\nCalculated Molecular Weight: 81 kDa\nObserved Molecular Weight: 110-130 kDa\nGenBank Accession Number: NM_001032378\nGene Symbol: CD31\nGene ID (NCBI): 18613\nRRID: AB_2881055\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q08481\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868826587305,"sku":"28083-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28083-1-ap","provider":"Iright","version":"1.0","type":"link"}