{"product_id":"proteintech-28084-1-ap","title":"Proteintech, 28084-1-AP, ALG3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ALG3 (28084-1-AP) by Proteintech is a Polyclonal antibody targeting ALG3 in WB, IHC, ELISA applications with reactivity to Human, Mouse samples\n28084-1-AP targets ALG3 in WB, IHC, IF, ELISA applications and shows reactivity with Human, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells,  human placenta tissue,  mouse liver tissue\nPositive IHC detected in: mouse placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAlpha-1,3-mannosyltransferase (ALG3) encodes an endoplasmic reticulum-localized ALG3 family member that participates in N-glycan synthesis. ALG3 contributes to high mannose-type N-glycans in several cancers, and mannose-type N-glycan upregulation has been shown to be related to cancer progression. ALG3 is overexpressed in oral squamous cell carcinoma(PMID: 33084111), non-small cell lung cancer(PMID: 31899049), and breast cancer(PMID: 33931075) and hepatocellular carcinoma(PMID: 35782861).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26382 Product name: Recombinant human ALG3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-199 aa of BC002839 Sequence: MAAGLRKRGRSGSAAQAEGLCKQWLQRAWQERRLLLREPRYTLLVAACLCLAEVGITFWVIHRVAYTEIDWKAYMAEVEGVINGTYDYTQLQGDTGPLVYPAGFVYIFMGLYYATSRGTDIRMAQNIFAVLYLATLLLVFLIYHQTCKVPPFVFFFMCCASYRVHSIFVLRLFNDPVAMVLLFLSINLLLAQRWGWGCC Predict reactive species\nFull Name: asparagine-linked glycosylation 3, alpha-1,3- mannosyltransferase homolog (S. cerevisiae)\nCalculated Molecular Weight: 438 aa, 50 kDa\nObserved Molecular Weight: 50-60 kDa\nGenBank Accession Number: BC002839\nGene Symbol: ALG3\nGene ID (NCBI): 10195\nRRID: AB_3669644\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92685\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869634220201,"sku":"28084-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28084-1-ap","provider":"Iright","version":"1.0","type":"link"}