{"product_id":"proteintech-28090-1-ap","title":"Proteintech, 28090-1-AP, CAMK2N2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CAMK2N2 (28090-1-AP) by Proteintech is a Polyclonal antibody targeting CAMK2N2 in IHC, ELISA applications with reactivity to Human, mouse samples\n28090-1-AP targets CAMK2N2 in IHC, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCalcium\/calmodulin-dependent protein kinase II (CaMKII) is a key synaptic signaling molecule that regulates numerous physiological functions. CaMK2N2, also known as CAMKIIN, is one of the endogenous inhibitors of CaMKII. CaMK2N2 plays an important role in the regulation of cell growth (PMID: 11444830).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26872 Product name: Recombinant human CAMK2N2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-79 aa of BC105077 Sequence: MSEILPYSEDKMGRFGADPEGSDLSFSCRLQDTNSFFAGNQAKRPPKLGQIGRAKRVVIEDDRIDDVLKGMGEKPPSGV Predict reactive species\nFull Name: calcium\/calmodulin-dependent protein kinase II inhibitor 2\nGenBank Accession Number: BC105077\nGene Symbol: CAMK2N2\nGene ID (NCBI): 94032\nRRID: AB_3086027\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96S95\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885781831849,"sku":"28090-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28090-1-ap","provider":"Iright","version":"1.0","type":"link"}