{"product_id":"proteintech-28096-1-ap","title":"Proteintech, 28096-1-AP, GPR141 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPR141 (28096-1-AP) by Proteintech is a Polyclonal antibody targeting GPR141 in IHC, ELISA applications with reactivity to Human, mouse samples\n28096-1-AP targets GPR141 in IHC, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human kidney tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGPR141 (G-protein-coupled receptor 141) is a class A orphan receptor molecule of the rhodopsin family. Increased GPR141 expression enhances the migratory behavior of breast cancer, driving oncogenic pathways both in vitro and in vivo through activation of epithelial to mesenchymal transition (EMT), oncogenic mediators, and regulation of p-mTOR\/p53 signaling (PMID: 37204251).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23129 Product name: Recombinant human GPR141 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 246-305 aa of BC120951 Sequence: IYYLNVVTHSNACNSKVAFYNEIFLSVTAISCYDLLLFVFGGSHWFKQKIIGLWNCVLCR Predict reactive species\nFull Name: G protein-coupled receptor 141\nCalculated Molecular Weight: 305 aa, 35 kDa\nGenBank Accession Number: BC120951\nGene Symbol: GPR141\nGene ID (NCBI): 353345\nRRID: AB_3086028\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7Z602\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887656128681,"sku":"28096-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28096-1-ap","provider":"Iright","version":"1.0","type":"link"}