{"product_id":"proteintech-28114-1-ap","title":"Proteintech, 28114-1-AP, UQCC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UQCC (28114-1-AP) by Proteintech is a Polyclonal antibody targeting UQCC in WB, IHC, ELISA applications with reactivity to human samples\n28114-1-AP targets UQCC in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  K-562 cells,  MCF-7 cells,  LNCaP cells\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUQCC is a transmembrane protein that is structurally similar to the mouse basic fibroblast growth factor repressed ZIC-binding protein. In mouse this protein may be involved in fibroblast growth factor regulated growth control. In humans, polymorphisms in this gene are associated with variation in human height and osteoarthritis. Alternate splicing results in multiple transcript variant.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27123 Product name: Recombinant human UQCC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 140-299 aa of BC105791 Sequence: PDTFNSWFLITLLHVWMCLVRMKQEGRSGKYMCRIIVHFMWEDVQQRGRVMGVNPYILKKNMILMTNHFYAAILGYDEGILSDDHGLAAALWRTFFNRKCEDPRHLELLVEYVRKQIQYLDSMNGEDLLLTGEVSWRPLVEKNPQSILKPHSPTYNDEGL Predict reactive species\nFull Name: ubiquinol-cytochrome c reductase complex chaperone\nCalculated Molecular Weight: 299 aa, 35 kDa\nObserved Molecular Weight: 21-27 kDa\nGenBank Accession Number: BC105791\nGene Symbol: UQCC\nGene ID (NCBI): 55245\nRRID: AB_2881065\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NVA1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887917912233,"sku":"28114-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28114-1-ap","provider":"Iright","version":"1.0","type":"link"}