{"product_id":"proteintech-28145-1-ap","title":"Proteintech, 28145-1-AP, DOT1L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DOT1L (28145-1-AP) by Proteintech is a Polyclonal antibody targeting DOT1L in WB, ELISA applications with reactivity to human, rat samples\n28145-1-AP targets DOT1L in WB, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDOT1L (Disruptor of telomeric silencing 1-like) is the only known histone methyltransferse catalyzing H3K79 methylation which is an activating mark for gene transcription by promoting transcriptional elongation (PMID: 34187895). DOT1L forms a complex with AF10\/AF17 and ENL\/AF9, is dysregulated in mixed-lineage leukemia (MLLr), and is believed to regulate transcriptional elongation without direct evidence. DOT1L has been reported to directly interact with RNAPII phosphorylated on Ser2 and\/or Ser5 of the C-terminal domain (CTD) of its largest subunit. Loss of Dot1L results in yolk sac angiogenesis defects and embryonic lethality (PMID: 18787701).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27229 Product name: Recombinant human DOT1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 511-698 aa of NM_032482 Sequence: MLQELLGQEKEKNAQLLGAAQQLLSHCQAQKEEIRRLFQQKLDELGVKALTYNDLIQAQKEISAHNQQLREQSEQLEQDNRALRGQSLQLLKARCEELQLDWATLSLEKLLKEKQALKSQISEKQRHCLELQISIVELEKSQRQQELLQLKSCVPPDDALSLHLRGKGALGRELEPDASRLHLELDCTK Predict reactive species\nFull Name: DOT1-like, histone H3 methyltransferase (S. cerevisiae)\nCalculated Molecular Weight: 185 kDa\nObserved Molecular Weight: 185~200 kDa\nGenBank Accession Number: NM_032482\nGene Symbol: DOT1L\nGene ID (NCBI): 84444\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TEK3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887293124777,"sku":"28145-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28145-1-ap","provider":"Iright","version":"1.0","type":"link"}