{"product_id":"proteintech-28151-1-ap","title":"Proteintech, 28151-1-AP, PTPRK Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PTPRK (28151-1-AP) by Proteintech is a Polyclonal antibody targeting PTPRK in WB, ELISA applications with reactivity to Human, mouse, rat samples\n28151-1-AP targets PTPRK in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse spleen tissue, rat spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPTPRK (Protein Tyrosine Phosphatase Receptor Type Kappa), a member of the receptor-type protein tyrosine phosphatase family, is a transmembrane protein that regulates cell-cell contact. PTPRK is a 210 kDa precursor protein and converted by furin to a mature heterodimeric protein composed of a non-covalently attached amino-terminal extracellular subunit (E-subunit, 120 kDa) and carboxyl-terminal transmembrane subunit (P-subunit, 95 kDa) (PMID: 24882578, 16648485). Loss of PTPRK activity has been observed in pancreatic cancer, primary CNS lymphoma and melanoma, and is associated with poor survival of cancer patients, which suggest that PTPRK is a potential tumor suppressor (PMID: 23696788).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27765 Product name: Recombinant human PTPRK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 635-750 aa of BC140775 Sequence: EELHPHRTKREAGAMECYQVPVTYQNAMSGGAPYYFAAELPPGNLPEPAPFTVGDNRTYQGFWNPPLAPRKGYNIYFQAMSSVEKETKTQCVRIATKAAATEEPEVIPDPAKQTDR Predict reactive species\nFull Name: protein tyrosine phosphatase, receptor type, K\nCalculated Molecular Weight: 1439 aa, 162 kDa\nObserved Molecular Weight: 100-120 kDa\nGenBank Accession Number: BC140775\nGene Symbol: PTPRK\nGene ID (NCBI): 5796\nRRID: AB_2881074\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15262\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887777271977,"sku":"28151-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28151-1-ap","provider":"Iright","version":"1.0","type":"link"}