{"product_id":"proteintech-28174-1-ap","title":"Proteintech, 28174-1-AP, SCARF1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SCARF1 (28174-1-AP) by Proteintech is a Polyclonal antibody targeting SCARF1 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n28174-1-AP targets SCARF1 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, SMMC-7721 cells\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nScavenger receptor class F member 1 (SCARF1), also known as scavenger receptor expressed by endothelial cells (SREC)-I, belongs to the scavenger receptor (SR) superfamily. SCARF1 has been shown to bind modified low density lipoproteins (LDLs), including acetylated (Ac-) and oxidized (ox-) LDLs (PMID: 29725698; PMID: 15145948). In addition to binding and internalizing a diverse range of endogenous proteins, SCARF1 also binds a wide array of viral, fungal, and bacterial antigens (PMID: 29242513). SCARF1 has a calculated molecular weight of 87 kDa, with a molecular weight of 140-160 kDa due to N-glycosylation (PMID: 22279061; PMID: 15145948). SCARF1 can also exist as a dimer (~ 180 kDa) and a truncated soluble form (~ 60 kDa) (PMID: 29242513; PMID: 29725698).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28079 Product name: Recombinant human SCARF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 695-830 aa of BC039735 Sequence: AGKPRGSEGPVRSVFRHFGSFQKGQAEAKVKRAIPKPPRQALNRKKGSPGLASGSVGQSPNSAPKAGLPGATGPMAVRPEEAVRGLGAGTESSRRAQEPVSGCGSPEQDPQKQAEEERQEEPEYENVVPISRPPEP Predict reactive species\nFull Name: scavenger receptor class F, member 1\nCalculated Molecular Weight: 830 aa, 87 kDa\nObserved Molecular Weight: 90 kDa, 180 kDa\nGenBank Accession Number: BC039735\nGene Symbol: SCARF1\nGene ID (NCBI): 8578\nRRID: AB_3086035\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14162\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887793229993,"sku":"28174-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28174-1-ap","provider":"Iright","version":"1.0","type":"link"}