{"product_id":"proteintech-28175-1-ap","title":"Proteintech, 28175-1-AP, APH1B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe APH1B (28175-1-AP) by Proteintech is a Polyclonal antibody targeting APH1B in WB, ELISA applications with reactivity to human, mouse, rat samples\n28175-1-AP targets APH1B in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: fetal human brain tissue, mouse brain tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14066 Product name: Recombinant human APH1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 196-257 aa of BC020905 Sequence: HLLVSAQTFISSYYGINLASAFIILVLMGTWAFLAAGGSCRSLKLCLLCQDKNFLLYNQRSR Predict reactive species\nFull Name: anterior pharynx defective 1 homolog B (C. elegans)\nCalculated Molecular Weight: 257 aa, 28 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC020905\nGene Symbol: APH1B\nGene ID (NCBI): 83464\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WW43\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46884978327721,"sku":"28175-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28175-1-ap","provider":"Iright","version":"1.0","type":"link"}