{"product_id":"proteintech-28178-1-ap","title":"Proteintech, 28178-1-AP, CDC123\/C10orf7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CDC123\/C10orf7 (28178-1-AP) by Proteintech is a Polyclonal antibody targeting CDC123\/C10orf7 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n28178-1-AP targets CDC123\/C10orf7 in WB, IHC, IF\/ICC, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, HeLa cells,  Jurkat cells\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26828 Product name: Recombinant human CDC123 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 289-318 aa of BC001600 Sequence: CTNSEVTVQPSPYLSYRLPKDFVDLSTGED Predict reactive species\nFull Name: cell division cycle 123 homolog (S. cerevisiae)\nCalculated Molecular Weight: 39 kDa\nObserved Molecular Weight: 35-39 kDa\nGenBank Accession Number: BC001600\nGene Symbol: CDC123\nGene ID (NCBI): 8872\nRRID: AB_2881081\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75794\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869653913769,"sku":"28178-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28178-1-ap","provider":"Iright","version":"1.0","type":"link"}