{"product_id":"proteintech-28201-1-ap","title":"Proteintech, 28201-1-AP, ASK1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ASK1 (28201-1-AP) by Proteintech is a Polyclonal antibody targeting ASK1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n28201-1-AP targets ASK1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  A431 cells,  BxPC-3 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human pancreas cancer tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nASK1(Apoptosis signal-regulating kinase 1) is also named as MAP3K5, MAPKKK5, MEKK5 and belongs to the MAP kinase kinase kinase subfamily. It is an evolutionarily conserved mitogen activated protein 3-kinase that activates both Jnk and p38 mitogen-activated protein kinases. ASK1 is activated in response to various cytotoxic stresses including TNF, Fas and reactive oxygen species (ROS) such as H2O2, and activates c-Jun NH 2-terminal kinase (JNK) and p38. 28201-1-AP antibody detects the 155 kDa band in SDS-PAGE.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28092 Product name: Recombinant human ASK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1180-1374 aa of BC054503 Sequence: LASESDTADQEDLDVEDDHEEQPSNQTVRRPQAVIEDAVATSGVSTLSSTVSHDSQSAHRSLNVQLGRMKIETNRLLEELVRKEKELQALLHRAIEEKDQEIKHLKLKSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT Predict reactive species\nFull Name: mitogen-activated protein kinase kinase kinase 5\nCalculated Molecular Weight: 155 kDa\nObserved Molecular Weight: 155 kDa\nGenBank Accession Number: BC054503\nGene Symbol: ASK1\nGene ID (NCBI): 4217\nRRID: AB_2782957\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99683\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868862435497,"sku":"28201-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28201-1-ap","provider":"Iright","version":"1.0","type":"link"}