{"product_id":"proteintech-28212-1-ap","title":"Proteintech, 28212-1-AP, SREBF2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SREBF2 (28212-1-AP) by Proteintech is a Polyclonal antibody targeting SREBF2 in WB, IP, ELISA applications with reactivity to human samples\n28212-1-AP targets SREBF2 in WB, IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HUVEC cells, HepG2 cells,  PC-3 cells,  HeLa cells\nPositive IP detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSREBF2,also named as BHLHD2, is a 1141 amino acid protein, which contains 1 bHLH  domain and belongs to the SREBP family. SREBF2 localizes in the endoplasmic reticulum membrane and is ubiquitously expressed in adult and fetal tissues. SREBF2 as a transcriptional activator is  required for lipid homeostasis. SREBF2 expression is dynamically regulated in response to nutritional and hormonal cues. SREBF2 exists two isoform with molecular weight 124 kDa and 73 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat, pig, hamster, sheep\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28205 Product name: Recombinant human SREBF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 375-479 aa of BC056158 Sequence: DYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDNEVDLKIEDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDR Predict reactive species\nFull Name: sterol regulatory element binding transcription factor 2\nCalculated Molecular Weight: 124 kDa\nObserved Molecular Weight: 73-75 kDa, 120-130 kDa\nGenBank Accession Number: BC056158\nGene Symbol: SREBF2\nGene ID (NCBI): 6721\nRRID: AB_2881091\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q12772\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868835664041,"sku":"28212-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28212-1-ap","provider":"Iright","version":"1.0","type":"link"}