{"product_id":"proteintech-28214-1-ap","title":"Proteintech, 28214-1-AP, NPPB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NPPB (28214-1-AP) by Proteintech is a Polyclonal antibody targeting NPPB in IHC, ELISA applications with reactivity to human, mouse, rat samples\n28214-1-AP targets NPPB in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse heart tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNPPB, also known as B-type natriuretic peptide (BNP), is a cardiac hormone that is secreted mainly in the ventricles in response to increased wall stress. The protein undergoes two cleavage events, one within the cell and a second after secretion into the blood. The protein's biological actions include natriuresis, diuresis, vasorelaxation, inhibition of renin and aldosterone secretion, and a key role in cardiovascular homeostasis. BNP is a marker of systolic and diastolic dysfunction and a strong predictor of mortality in heart failure patients.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28133 Product name: Recombinant human BNP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-134 aa of BC025785 Sequence: HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH Predict reactive species\nFull Name: natriuretic peptide precursor B\nCalculated Molecular Weight: 134 aa, 15 kDa\nGenBank Accession Number: BC025785\nGene Symbol: BNP\nGene ID (NCBI): 4879\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P16860\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887741128873,"sku":"28214-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28214-1-ap","provider":"Iright","version":"1.0","type":"link"}