{"product_id":"proteintech-28245-1-ap","title":"Proteintech, 28245-1-AP, GLI2-Specific Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GLI2-Specific (28245-1-AP) by Proteintech is a Polyclonal antibody targeting GLI2-Specific in WB, IHC, ELISA applications with reactivity to human samples\n28245-1-AP targets GLI2-Specific in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, U2OS cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGLI2, along with the related GLI1 and GLI3, is a member of the GLI family of transcription factors belonging to the Glis superfamily. Glioma-Associated Oncogene Family Zinc Finger 2 (GLI2) is a zinc-finger transcription factor involved in the Sonic Hedgehog pathway. GLI2 is involved in proliferation, invasion, fibrosis, and is involved in carcinogenesis in various malignancies including gastric cancer, lung cancer, prostate cancer, bladder cancer, and so on.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28422 Product name: Recombinant human GLI2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 601-795 aa of NM_005270 Sequence: NDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTESSGLCQSSPGAQSSCSSEPSPLGSAPNNDSGVEMPGTGPGSLGDLTALDDTPPGADTSALAAPSAGGLQLRKHMTTMHRFEQLKKEKLKSLKDSCSWAGPTPHTRNTKLPPLPGSGSILENFSGSGGGGPAGLLPNPRLSELSASE Predict reactive species\nFull Name: GLI family zinc finger 2\nCalculated Molecular Weight: 168 aa\nObserved Molecular Weight: 180-200 kDa\nGenBank Accession Number: NM_005270\nGene Symbol: GLI2\nGene ID (NCBI): 2736\nRRID: AB_3086041\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P10070\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869687795881,"sku":"28245-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28245-1-ap","provider":"Iright","version":"1.0","type":"link"}