{"product_id":"proteintech-28270-1-ap","title":"Proteintech, 28270-1-AP, Calmodulin 1\/2\/3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Calmodulin 1\/2\/3 (28270-1-AP) by Proteintech is a Polyclonal antibody targeting Calmodulin 1\/2\/3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n28270-1-AP targets Calmodulin 1\/2\/3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue, rat skeletal muscle tissue\nPositive IHC detected in: rat brain tissue, mouse brain tissue,  mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCalmodulin is the most widely distributed and most versatile member of a family of calcium-binding proteins which probably serve as receptors for the Ca2+ signal. Through the regulation of a wide variety of intracellular enzymes, calmodulin plays a key role in many physiological processes (PMID: 6313166).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28000 Product name: Recombinant human CALM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 72-149 aa of BC006464 Sequence: MMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK Predict reactive species\nFull Name: calmodulin 2 (phosphorylase kinase, delta)\nCalculated Molecular Weight: 17 kDa\nObserved Molecular Weight: 17-22 kDa\nGenBank Accession Number: BC006464\nGene Symbol: Calmodulin 1\nGene ID (NCBI): 805\nRRID: AB_3669650\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P62158\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885768429737,"sku":"28270-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28270-1-ap","provider":"Iright","version":"1.0","type":"link"}