{"product_id":"proteintech-28272-1-ap","title":"Proteintech, 28272-1-AP, GLI3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GLI3 (28272-1-AP) by Proteintech is a Polyclonal antibody targeting GLI3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n28272-1-AP targets GLI3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, SKOV-3 cells\nPositive IHC detected in: mouse testis tissue, human colon cancer tissue,  human prostate cancer tissue,  rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGLI3 belongs to the GLI C2H2-type zinc-finger protein family. GLI3 plays a role in limb and brain development. GLI3 is implicated in the transduction of SHH signal. Defects in GLI3 are the cause of Greig cephalo-poly-syndactyly syndrome (GCPS). Defects in GLI3 are a cause of Pallister-Hall syndrome (PHS). Defects in GLI3 are a cause of type A1\/B postaxial polydactyly (PAPA1\/PAPB). Defects in GLI3 are a cause of type IV preaxial polydactyly. Defects in GLI3 are the cause of acrocallosal syndrome (ACS). The antibody is specific to GLI3. At the molecular level, Gli3 is translated into a 190-kDa transcriptional activator (Gli3-190) that undergoes proteolytic processing into a truncated 83-kDa repressor (Gli3-83) lacking C-terminal activation domains. (PMID: 16705181)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28472 Product name: Recombinant human GLI3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 641-880 aa of NM_000168 Sequence: MKQRGDIHPRPPPPRDSGSHSQSRSPGRPTQGALGEQQDLSNTTSKREECLQVKTVKAEKPMTSQPSPGGQSSCSSQQSPISNYSNSGLELPLTDGGSIGDLSAIDETPIMDSTISTATTALALQARRNPAGTKWMEHVKLERLKQVNGMFPRLNPILPPKAPAVSPLIGNGTQSNNTCSLGGPMTLLPGRSDLSGVDVTMLNMLNRRDSSASTISSAYLSSRRSSGISPCFSSRRSSEAS Predict reactive species\nFull Name: GLI family zinc finger 3\nCalculated Molecular Weight: 170 aa\nObserved Molecular Weight: 170-190 kDa, 80-90 kDa\nGenBank Accession Number: NM_000168\nGene Symbol: GLI3\nGene ID (NCBI): 2737\nRRID: AB_2881101\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P10071\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869544960169,"sku":"28272-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28272-1-ap","provider":"Iright","version":"1.0","type":"link"}