{"product_id":"proteintech-28315-1-ap","title":"Proteintech, 28315-1-AP, SCN4A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SCN4A (28315-1-AP) by Proteintech is a Polyclonal antibody targeting SCN4A in IHC, ELISA applications with reactivity to human, mouse samples\n28315-1-AP targets SCN4A in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSodium channel protein type 4 subunit alpha (SCN4A, also known as Nav1.4) is the pore-forming subunit of the primary sodium channel present in skeletal muscles (PMID: 16193245). Nav1.4 related channelopathies that affect skeletal muscle excitability are dominant diseases classified in two opposite groups as defined by the prevalent clinical symptoms: muscle stiffness and hypertonia (myotonia) episodes [non dystrophic myotonias (NDM)], and muscle weakness resulting in paralysis episodes (periodic paralyses; PP) (PMID: 20237798; 26285000).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27536 Product name: Recombinant human SCN4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 803-1026 aa of NM_000334 Sequence: MSSFSADSLAASDEDGEMNNLQIAIGRIKLGIGFAKAFLLGLLHGKILSPKDIMLSLGEADGAGEAGEAGETAPEDEKKEPPEEDLKKDNHILNHMGLADGPPSSLELDHLNFINNPYLTIQVPIASEESDLEMPTEEETDTFSEPEDSKKPPQPLYDGNSSVCSTADYKPPEEDPEEQAEENPEGEQPEECFTEACVQRWPCLYVDISQGRGKKWWTLRRACFK Predict reactive species\nFull Name: sodium channel, voltage-gated, type IV, alpha subunit\nCalculated Molecular Weight: 208 kDa\nGenBank Accession Number: NM_000334\nGene Symbol: SCN4A\nGene ID (NCBI): 6329\nRRID: AB_2881109\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P35499\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887794180265,"sku":"28315-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28315-1-ap","provider":"Iright","version":"1.0","type":"link"}