{"product_id":"proteintech-28359-1-ap","title":"Proteintech, 28359-1-AP, UNC93B1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UNC93B1 (28359-1-AP) by Proteintech is a Polyclonal antibody targeting UNC93B1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig samples\n28359-1-AP targets UNC93B1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse spleen tissue, rat kidney tissue,  rat spleen tissue,  pig spleen tissue\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUnc-93 homolog B1 (UNC93B1) is a key regulator of nucleic acid (NA)-sensing Toll-like receptors (TLRs). UNC93B1 plays an important role in innate and adaptive immunity by regulating nucleotide-sensing Toll-like receptor (TLR) signaling. It's a transmembrane protein that is known to control the movement of TLRs from the endoplasmic reticulum-where TLRs are assembled-to endosomes. The calculated MW of UNC93B1 is 66 kDa, 28359-1-AP can detect a band around 70 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27937 Product name: Recombinant human UNC93B1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-109 aa of BC101568 Sequence: MEAEPPLYPMAGAAGPQGDEDLLGVPDGPEAPLDELVGAYPNYNEEEEERRYYRRKRLGVLKNVLAASAGGMLTYGVYLGLLQMQLILHYDETYREVKYGNMGLPDIDS Predict reactive species\nFull Name: unc-93 homolog B1 (C. elegans)\nCalculated Molecular Weight: 597 aa, 67 kDa\nObserved Molecular Weight: ~70 kDa\nGenBank Accession Number: BC101568\nGene Symbol: UNC93B1\nGene ID (NCBI): 81622\nRRID: AB_3086046\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H1C4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869785411753,"sku":"28359-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28359-1-ap","provider":"Iright","version":"1.0","type":"link"}