{"product_id":"proteintech-28363-1-ap","title":"Proteintech, 28363-1-AP, MAEA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MAEA (28363-1-AP) by Proteintech is a Polyclonal antibody targeting MAEA in WB, IHC, ELISA applications with reactivity to Human samples\n28363-1-AP targets MAEA in WB, IHC, IP, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, Jurkat cells\nPositive IHC detected in: human liver cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMAEA(macrophage erythroblast attacher) is a core component of the CTLH E3 ubiquitin-protein ligase complex. MAEA is required for normal cell proliferation and plays a role in erythroblast enucleation during erythrocyte maturation and in the development of mature macrophages. N-terminus MAEA and full-length MAEA are mostly expressed in nuclear and can be detected at low level in the cytoplasm of some cells, while C-terminus MAEA can be detected in the cytoplasm and nucleoli within the nucleus. MAEA mediates the attachment of erythroid cell to mature macrophages which can inhibit erythroid cell apoptosis. The expression of MAEA may be  associated with the type 2 diabetes mellitus.(PubMed: 28955747, 24143168, 29911972, 29911972, 30674470, 9763581).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27150 Product name: Recombinant human MAEA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-239 aa of BC001225 Sequence: YETLNKRFRAAQKNIDRETSHVTMVVAELEKTLSGCPAVDSVVSLLDGVVEKLSVLKRKAVESIQAEDESAKLCKRRIEHLKEHSSDQPAAASVWKRKRMDRMMVEHLLRCGYYNTAVKLARQSGIEDLVNIEMFLTAKEVEESLERRETATCLAWCHDNKSRLRKMKSCLEFSLRIQEFIELIRQNKRLDAVRHARKHFSQAEGSQLDEVRQA Predict reactive species\nFull Name: macrophage erythroblast attacher\nCalculated Molecular Weight: 45 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC001225\nGene Symbol: MAEA\nGene ID (NCBI): 10296\nRRID: AB_2881122\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7L5Y9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868969652393,"sku":"28363-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28363-1-ap","provider":"Iright","version":"1.0","type":"link"}