{"product_id":"proteintech-28371-1-ap","title":"Proteintech, 28371-1-AP, AURKA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AURKA (28371-1-AP) by Proteintech is a Polyclonal antibody targeting AURKA in WB, IF\/ICC, ELISA applications with reactivity to human samples\n28371-1-AP targets AURKA in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  SW 1990 cells\nPositive IF\/ICC detected in: Caco-2 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAURKA(Aurora kinase A), also named as STK6, STK15 or AIK, belongs to the Ser\/Thr protein kinase family. This protein may play a role in cell cycle regulation during anaphase and\/or telophase by being involved in microtubule formation and\/or stabilization. Some recent evidence revealed that AURKA may also be implicated in tumor development and progression. AURKA is expressed highly in testis and various proliferating cells, migrating as a 46 kDa protein in SDS PAGE.Nuclear staining for AURKA is weak or nonexistent in normal tissue but strong in tumor tissue(PMID:19107951).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29006 Product name: Recombinant human AURKA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-132 aa of BC002499 Sequence: MDRSKENCISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRVPLQAQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEELASKQKNEESKKRQWALED Predict reactive species\nFull Name: aurora kinase A\nCalculated Molecular Weight: 46 kDa\nObserved Molecular Weight: 45-50 kDa\nGenBank Accession Number: BC002499\nGene Symbol: AURKA\nGene ID (NCBI): 6790\nRRID: AB_3086047\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14965\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869641199785,"sku":"28371-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28371-1-ap","provider":"Iright","version":"1.0","type":"link"}