{"product_id":"proteintech-28447-1-ap","title":"Proteintech, 28447-1-AP, NCX1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NCX1 (28447-1-AP) by Proteintech is a Polyclonal antibody targeting NCX1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n28447-1-AP targets NCX1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, rat heart tissue,  rat kidney tissue,  mouse kidney tissue\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:200-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC8A1, also known as NCX1, belongs to the SLC (Solute Carrier) family and the CaCA (Calcium\/Cation Antiporter) superfamily. NCX1 is a bidirectional ion exchanger that can exchange sodium and calcium ions between the inside and outside of cells in a 1:3 ratio (1 Ca2+ ion and 3 Na+ ions). Under physiological conditions, NCX1 mainly transports Ca2+ from the cell interior to the exterior through the forward transport mode to maintain the low calcium level inside the cell. However, under certain special conditions, such as ischemia-reperfusion injury and stroke, the reverse transport mode of NCX1 is activated, leading to the influx of Ca2+ into the cell, which may cause cell damage (PMID: 21289289, 30686898).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28952 Product name: Recombinant human SLC8A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-59 aa of NM_021097 Sequence: MYNMRRLSLSPTFSMGFHLLVTVSLLFSHVDHVIAETEMEGEGNETGECTGSYYCKKGV Predict reactive species\nFull Name: solute carrier family 8 (sodium\/calcium exchanger), member 1\nCalculated Molecular Weight: 109 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: NM_021097\nGene Symbol: NCX1\nGene ID (NCBI): 6546\nRRID: AB_2918167\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P32418\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869005533353,"sku":"28447-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28447-1-ap","provider":"Iright","version":"1.0","type":"link"}