{"product_id":"proteintech-28456-1-ap","title":"Proteintech, 28456-1-AP, HPF1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HPF1 (28456-1-AP) by Proteintech is a Polyclonal antibody targeting HPF1 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n28456-1-AP targets HPF1 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, MOLT-4 cells\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHPF1 is also known as C4orf27 and belongs to the HPF1 family. HPF1 is a novel interacting component of PARP1 complex that plays an important role in PARP1-dependent ADP-ribosylation signaling in the DNA damage response and the maintenance of genome stability (PMID: 29549427). The calculated molecular weight of HPF1 is 39 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29377 Product name: Recombinant human C4orf27 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC010367 Sequence: MVGGGGKRRPGGEGPQCEKTTDVKKSKFCEADVSSDLRKEVENHYKLSLPEDFYHFWKFCEELDPEKPSDSLSASLGLQLVGPYDILAGKHKTKKKSTGLNFNLHWRFYYDPPEFQTIIIGDNKTQYH Predict reactive species\nFull Name: chromosome 4 open reading frame 27\nCalculated Molecular Weight: 346 aa, 39 kDa\nObserved Molecular Weight: 39 kDa\nGenBank Accession Number: BC010367\nGene Symbol: HPF1\nGene ID (NCBI): 54969\nRRID: AB_3086053\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NWY4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887671070889,"sku":"28456-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28456-1-ap","provider":"Iright","version":"1.0","type":"link"}