{"product_id":"proteintech-28475-1-ap","title":"Proteintech, 28475-1-AP, IL-1 alpha Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-1 alpha (28475-1-AP) by Proteintech is a Polyclonal antibody targeting IL-1 alpha in WB, ELISA applications with reactivity to human samples\n28475-1-AP targets IL-1 alpha in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PMA, LPS and Brefeldin A treated THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterleukin-1α (IL-1 alpha) is a protein that plays a crucial role in the regulation of a number of key cellular processes. IL-1 Alpha is a cytokine and a potent mediator of body's response to inflammation, microbial invasion, tissue injury and immunological response. In addition, recent studies suggest that IL-1 Alpha also has a role in wound healing, rheumatoid arthritis, Alzheimer's disease and tumor growth. IL-1 Alpha functions as an alarmin during the process of sterile inflammation. It serves as a signal from dying cells to potentiate the inflammatory response, increasing the expression of other secreted factors like IL-6 and IL-8. IL-1 Alpha was found to affect the cell cycle of osteosarcoma cell to reduce cell growth. IL-1 Alpha is initially translated as approximately 30-kD polypeptides that are processed to approximately 17.5-kD polypeptides prior to, or during, release from macrophages.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29587 Product name: Recombinant human IL-1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 113-271 aa of BC013142 Sequence: SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA Predict reactive species\nFull Name: interleukin 1, alpha\nCalculated Molecular Weight: 271 aa, 31 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC013142\nGene Symbol: IL-1 alpha\nGene ID (NCBI): 3552\nRRID: AB_2918169\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P01583\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869550661801,"sku":"28475-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28475-1-ap","provider":"Iright","version":"1.0","type":"link"}