{"product_id":"proteintech-28488-1-ap","title":"Proteintech, 28488-1-AP, GAT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GAT1 (28488-1-AP) by Proteintech is a Polyclonal antibody targeting GAT1 in WB, IHC, ELISA applications with reactivity to Human, Mouse, Rat samples\n28488-1-AP targets GAT1 in WB, IHC, IF, ELISA applications and shows reactivity with Human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: mouse cerebellum tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29712 Product name: Recombinant human SLC6A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-52 aa of BC033904 Sequence: MATNGSKVADGQISTEVSEAPVANDKPKTLVVKVQKKAADLPDRDTWKGRFD Predict reactive species\nFull Name: solute carrier family 6 (neurotransmitter transporter, GABA), member 1\nCalculated Molecular Weight: 67 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC033904\nGene Symbol: GABA Transporter 1\/GAT1\nGene ID (NCBI): 6529\nRRID: AB_2881154\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P30531\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868998095017,"sku":"28488-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28488-1-ap","provider":"Iright","version":"1.0","type":"link"}