{"product_id":"proteintech-28541-1-ap","title":"Proteintech, 28541-1-AP, FBXO32 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FBXO32 (28541-1-AP) by Proteintech is a Polyclonal antibody targeting FBXO32 in IHC, ELISA applications with reactivity to human, mouse samples\n28541-1-AP targets FBXO32 in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFBXO32 (F box only protein 32), also known as Atrogin 1 or MAFbx, is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif F-box. This protein is an E3 ubiquitin ligase that is markedly up-regulated in muscle atrophy. FBXO32 is thus a potential drug target for the treatment of muscle atrophy. Some data support that FBXO32 may play an important role in tumorigenesis. Recent study reveal that FBXO32 targets the oncogenic protein c-Myc for ubiquitination and degradation through the proteasome pathway.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29410 Product name: Recombinant human FBXO32 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 50-120 aa of BC024030 Sequence: MWVYRMETILHWQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLL Predict reactive species\nFull Name: F-box protein 32\nCalculated Molecular Weight: 355 aa, 42 kDa\nGenBank Accession Number: BC024030\nGene Symbol: FBXO32\nGene ID (NCBI): 114907\nRRID: AB_3086062\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q969P5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887636697257,"sku":"28541-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28541-1-ap","provider":"Iright","version":"1.0","type":"link"}