{"product_id":"proteintech-28543-1-ap","title":"Proteintech, 28543-1-AP, Integrin Beta 5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Integrin Beta 5 (28543-1-AP) by Proteintech is a Polyclonal antibody targeting Integrin Beta 5 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n28543-1-AP targets Integrin Beta 5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells\nPositive IHC detected in: human pancreas cancer tissue, mouse placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29783 Product name: Recombinant human Integrin beta-5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-126 aa of BC006541 Sequence: GLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSITSRCDLRANLVKNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRPGDKTTF Predict reactive species\nFull Name: integrin, beta 5\nCalculated Molecular Weight: 88 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC006541\nGene Symbol: Integrin beta 5\nGene ID (NCBI): 3693\nRRID: AB_2881167\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P18084\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868934328489,"sku":"28543-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28543-1-ap","provider":"Iright","version":"1.0","type":"link"}