{"product_id":"proteintech-28546-1-ap","title":"Proteintech, 28546-1-AP, Midkine Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Midkine (28546-1-AP) by Proteintech is a Polyclonal antibody targeting Midkine in WB, IHC, ELISA applications with reactivity to Human, mouse samples\n28546-1-AP targets Midkine in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse embryo tissue\nPositive IHC detected in: human pancreas cancer tissue, human stomach cancer tissue,  human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29185 Product name: Recombinant human MDK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 79-143 aa of BC011704 Sequence: EFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD Predict reactive species\nFull Name: midkine (neurite growth-promoting factor 2)\nCalculated Molecular Weight: 16 kDa\nObserved Molecular Weight: 16 kDa\nGenBank Accession Number: BC011704\nGene Symbol: Midkine\nGene ID (NCBI): 4192\nRRID: AB_2881168\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P21741\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869472477353,"sku":"28546-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28546-1-ap","provider":"Iright","version":"1.0","type":"link"}