{"product_id":"proteintech-28569-1-ap","title":"Proteintech, 28569-1-AP, HCFC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HCFC1 (28569-1-AP) by Proteintech is a Polyclonal antibody targeting HCFC1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n28569-1-AP targets HCFC1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, K-562 cells,  NIH\/3T3 cells,  PC-12 cells,  C2C12 cells,  C6 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: mouse liver tissue, human lung cancer tissue,  human urothelial carcinoma tissue,  mouse cerebellum tissue,  mouse lung tissue,  mouse skin tissue,  rat cerebellum tissue,  rat lung tissue,  rat skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHCFC1 (also known as HCF-1) was discovered in studies of herpes simplex virus (HSV) transcription. This nuclear coactivator is proteolytically cleaved at one of the six possible sites, resulting in the creation of an N-terminal chain and the corresponding C-terminal chain. The final form of this protein consists of noncovalently bound N- and C-terminal chains. The protein is involved in the control of the cell cycle and transcriptional regulation during herpes simplex virus infection. HCFC1 is a large protein of ∼300 kDa and is proteolytically processed into N- and C-terminal fragments of ∼150 kDa each.(PMID: 21295698 )\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29663 Product name: Recombinant human HCFC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1018-1174 aa of NM_005334 Sequence: CETHETGTTNTATTTVVANLGGHPQPTQVQFVCDRQEAAASLVTSTVGQQNGSVVRVCSNPPCETHETGTTNTATTATSNMAGQHGCSNPPCETHETGTTNTATTAMSSVGANHQRDARRACAAGTPAVIRISVATGALEAAQGSKSQCQTRQTSAT Predict reactive species\nFull Name: host cell factor C1 (VP16-accessory protein)\nCalculated Molecular Weight: 209 kDa\nObserved Molecular Weight: 300 kDa, 100-150 kDa\nGenBank Accession Number: NM_005334\nGene Symbol: HCFC1\nGene ID (NCBI): 3054\nRRID: AB_3086066\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P51610\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887664124073,"sku":"28569-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28569-1-ap","provider":"Iright","version":"1.0","type":"link"}