{"product_id":"proteintech-28587-1-ap","title":"Proteintech, 28587-1-AP, KIF23 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KIF23 (28587-1-AP) by Proteintech is a Polyclonal antibody targeting KIF23 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n28587-1-AP targets KIF23 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, U-87 MG cells\nPositive IHC detected in: human stomach cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKIF23, also known as KNSL5 and MKLP1, is a member of the kinesin-like protein family. It plays a crucial role in cytokinesis, the final stage of cell division. It is involved in the formation of the central spindle, which is essential for the proper separation of the cytoplasm and the formation of the cleavage furrow. KIF23 is also involved in the organization and transport of intracellular vesicles and organelles. Mutations in KIF23 have been associated with congenital dyserythropoietic anemia type III(PMID: 23570799).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29346 Product name: Recombinant human KIF23 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 486-683 aa of NM_138555 Sequence: LDINDEQTLPRLIEALEKRHNLRQMMIDEFNKQSNAFKALLQEFDNAVLSKENHMQGKLNEKEKMISGQKLEIERLEKKNKTLEYKIEILEKTTTIYEEDKRNLQQELETQNQKLQRQFSDKRRLEARLQGMVTETTMKWEKECERRVAAKQLEMQNKLWVKDEKLKQLKAIVTEPKTEKPERPSRERDREKVTQRSV Predict reactive species\nFull Name: kinesin family member 23\nCalculated Molecular Weight: 110 kDa\nObserved Molecular Weight: 110 kDa\nGenBank Accession Number: NM_138555\nGene Symbol: KIF23\nGene ID (NCBI): 9493\nRRID: AB_2881176\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q02241\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868957364393,"sku":"28587-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28587-1-ap","provider":"Iright","version":"1.0","type":"link"}