{"product_id":"proteintech-28599-1-ap","title":"Proteintech, 28599-1-AP, TAC1\/Substance P Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TAC1\/Substance P (28599-1-AP) by Proteintech is a Polyclonal antibody targeting TAC1\/Substance P in IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n28599-1-AP targets TAC1\/Substance P in IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse brain tissue, human hypothalamus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\nPositive IF\/ICC detected in: PC-12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTAC1, also known as Protachykinin-1, is a gene that encodes for a family of neuropeptides known as tachykinins. These peptides are characterized by their ability to rapidly stimulate contraction of intestinal muscle, hence the name \"tachykinins\". The TAC1 gene and its products are widely distributed in the nervous system, with α-TAC1 mRNA localized in numerous neurons of the brain. β-TAC1 and γ-TAC1 are predominantly expressed in intrinsic enteric neurons and sensory neurons. Additionally, the expression of TAC1, SP, and NKA is observed in various peripheral neurons and non-neural tissues such as the salivary gland, heart, skin, spleen, adrenal gland, and more.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23477 Product name: Recombinant human TAC1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 20-89 aa of BC018047 Sequence: EEIGANDDLNYWSDWYDSDQIKEELPEPFEHLLQRIARRPKPQQFFGLMGKRDADSSIEKQVALLKALYG Predict reactive species\nFull Name: tachykinin, precursor 1\nCalculated Molecular Weight: 129 aa, 15 kDa\nGenBank Accession Number: BC018047\nGene Symbol: TAC1\nGene ID (NCBI): 6863\nRRID: AB_2881178\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P20366\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887821803689,"sku":"28599-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28599-1-ap","provider":"Iright","version":"1.0","type":"link"}